purity assay comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-03-23. Where a claim depends on a specific study, the study is described rather than over-claimed.
Additional techniques address components that reversed-phase chromatography may not resolve. Ion-exchange chromatography separates by charge, size-exclusion chromatography detects aggregates, and capillary electrophoresis offers high separation efficiency. Water content is measured by Karl Fischer titration, residual solvents by gas chromatography, and elemental impurities by inductively coupled plasma mass spectrometry. Amino acid analysis or nitrogen determination can estimate peptide content on a mass basis. Purity is frequently reported as area percent, yet standardized comparison across laboratories remains an open question because methods and reporting practices differ.
Peptide purity testing measures how much of a sample consists of the intended peptide sequence compared with related substances, water, counterions, and residual solvents. No single analytical method captures all of these components at once. Reversed-phase high-performance liquid chromatography with ultraviolet detection is widely used because it separates peptides by hydrophobicity. The reported purity value therefore depends on the chosen method, column, mobile phase, and detection wavelength. Established practice treats purity as method-dependent rather than an absolute property of the material.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized peptides commonly appear as powders; color can vary with sequence. |
| Solubility class | Variable; often soluble in water or aqueous buffer | Depends on sequence, charge, and hydrophobicity. |
| Typical storage temperature | -20 °C or lower | Desiccated and protected from light; avoid repeated freeze-thaw cycles. |
| Typical analytical method | Reversed-phase HPLC with UV detection | Often paired with mass spectrometry for identity confirmation. |
| Common synonyms | Peptide purity analysis; peptide purity assay | Used in certificate of analysis and quality control contexts. |
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Storage and handling conditions affect both peptide stability and the accuracy of later purity tests. Lyophilized powders are commonly kept desiccated at -20 °C or below, while reconstituted solutions require a defined buffer, pH, and temperature range. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis over time. Each cycle may alter the chromatogram and complicate comparison with earlier results. Stability data, when available, should guide handling intervals and solvent choice.
Quality control includes system suitability, blank injections, and reference standards. System suitability checks column performance and retention time reproducibility, while blank runs detect carryover or mobile-phase contaminants. Reference standards help calibrate retention time and detector response. Without these controls, a purity value is difficult to compare across laboratories or over time. Documentation of instrument settings and integration parameters is also part of quality control, and acceptance criteria should be set before samples are analyzed.
Impurity profiles can include deletion peptides, oxidized forms, truncated sequences, and residual solvents. Some impurities arise during synthesis, cleavage, or purification, while others form during storage. Purity testing often focuses on peptide-related impurities, whereas residual solvents and counterions require separate assays. The significance of a given impurity depends on its amount and properties, which may not be established for a research peptide. Reporting an impurity profile is more informative than reporting a single purity number.
Peptide purity specifications describe the minimum acceptable result from a defined test. A certificate of analysis may list HPLC purity, mass spectrometry identity, appearance, and counterion content. Specifications are method-dependent, so a value obtained with one gradient or wavelength may differ from another. For research use, common thresholds include 95% and 98% by RP-HPLC, but the appropriate limit depends on the application. The specification should always name the analytical method and acceptance criterion.
Orthogonal separation methods address impurities that RP-HPLC may not resolve. Size-exclusion chromatography detects aggregates and higher-order species, while ion-exchange chromatography separates charge variants. Capillary electrophoresis can assess charge-to-mass ratios and, in some formats, size-based impurities. Amino acid analysis and nitrogen determination estimate peptide content rather than chromatographic purity. Because each technique has a different selectivity, a complete purity profile usually combines results from more than one method. The choice of method depends on the impurity classes of concern.
Reversed-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. Separation depends on interactions between peptide residues and a hydrophobic stationary phase, with gradients of water and organic solvent. Ultraviolet detection near 214 nm responds to the peptide backbone and to many related impurities. The resulting chromatogram is often expressed as area percent, which reports the proportion of peak area assigned to the main component. Different columns, gradients, and wavelengths can produce different purity values for the same material.
Mass spectrometry provides complementary information about molecular identity and certain impurities. Electrospray ionization and matrix-assisted laser desorption/ionization are common ionization techniques for peptides. A measured mass close to the expected value supports correct sequence length and modifications, while extra mass signals can reveal truncations, adducts, or incomplete deprotection. Mass spectrometry alone is not a quantitative purity assay, because ionization efficiency varies between compounds. Coupling liquid chromatography to mass spectrometry links retention time with mass and helps assign peaks that ultraviolet detection records.
Other methods address specific purity concerns. Amino acid analysis gives compositional data after hydrolysis, while capillary electrophoresis separates by charge-to-mass ratio. Karl Fischer titration measures residual water, and gas chromatography can detect residual solvents. Nuclear magnetic resonance can identify organic impurities but is less sensitive for trace levels. No single test covers all possible impurities, so purity testing usually combines orthogonal methods and reports the conditions used. The choice of methods is guided by the impurity classes of interest.
Reverse-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. It separates components by hydrophobicity on a column with a water-organic mobile phase. Ultraviolet absorbance at 214 nm or 220 nm detects peptide bonds. The main peak area as a percentage of total peak area gives a purity figure. This figure depends on column, gradient, wavelength, and how peaks are integrated, so it is method-specific rather than absolute.
The structure of the AG glycans consists of a backbone of β-1,3 linked galactose (Gal), with sidechains of β-1,6 linked Gal and have terminal residues of arabinose (Ara), rhamnose (Rha), Gal, fucose (Fuc), and glucuronic acid (GlcA). These AG glycan moieties are assembled by glycosyltransferases (GTs). O-glycosylation of AGPs is initiated by the action of Hyp-O-galactosyltransferases (Hyp-O-GalTs) that add the first Gal onto the protein. The complex glycan structures are then elaborated by a suite of glycosyltransferases, the majority of which are bio-chemically uncharacterized. The GT31 family is one of the families involved in AGP glycan backbone biosynthesis. Numerous members of the GT31 family have been identified with Hyp-O-GALT activity and the core β-(1,3)-galactan backbone is also likely to be synthesized by the GT31 family. Members of the GT14 family are implicated in adding β-(1,6)- and β-(1,3)-galactans to AGPs. In Arabidopsis, terminal sugars such as fucose are proposed to be added by AtFUT4 (a fucosyl transferase) and AtFUT6 in the GT37 family and the terminal GlcA incorporation can be catalysed by the GT14 family. A number of GTs remain to be identified, for example those responsible for terminal Rha.
As the salt of a weak base (ammonium) and a weak acid (acetic acid), is often used to create a buffer solution. Ammonium acetate is volatile at low pressures. Because of this, it has been used to replace cell buffers that contain non-volatile salts in preparing samples for mass spectrometry. It is also popular as a buffer for mobile phases for HPLC with ELSD and CAD-based detection for this reason. Other volatile salts that have been used for this include ammonium formate. When dissolving ammonium acetate in pure water, the resulting solution typically has a pH of 7, because the equal amounts of acetate and ammonium neutralize each other. However, ammonium acetate is a dual component buffer system, which buffers around pH 4.75 ± 1 (acetate) and pH 9.25 ± 1 (ammonium), but it has no significant buffer capacity at pH 7, contrary to common misconception.
Some anesthetics and chemotherapy drugs are injected intrathecally into the subarachnoid space, where they spread around CSF, meaning substances that cannot cross the blood–brain barrier can still be active throughout the central nervous system. Baricity refers to the density of a substance compared to the density of human cerebrospinal fluid and is used in regional anesthesia to determine the manner in which a particular drug will spread in the intrathecal space. Liquorpheresis is the process of filtering the CSF in order to clear it from endogen or exogen pathogens. It can be achieved by means of fully implantable or extracorporeal devices, though the technique remains experimental today.
The presentation of amyloidosis is broad and depends on the site of amyloid accumulation. The kidney and heart are the most common organs involved. Amyloid deposition in the kidney often involve the glomerular capillaries and mesangial regions, affecting the organ's ability to filter and excrete waste and retain plasma protein. This can lead to high levels of protein in the urine (proteinuria) and nephrotic syndrome. Several types of amyloidosis, including the AL and AA types, are associated with nephrotic syndrome. Approximately 20% and 40–60% of people with AL and AA amyloidosis respectively progress to end-stage kidney disease requiring dialysis.
Sources: en.wikipedia.org
2,4,6-Triisopropylbenzenesulfonyl azide (trisyl azide) is an organic chemical used as a reagent to supply azide for electrophilic amination reactions, such as for the asymmetric synthesis of unnatural amino acids. Introduction of an azide on the α carbon of carboxylic acid derivatives using trisyl azide is an efficient alternative to electrophilic halogenation followed by nucleophilic substitution using anionic azide. Using an oxazolidinone as chiral auxiliary typically gives good induction of the stereochemistry at the α position. Subsequent reduction converts the α-azide to an α-amine.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
C4H2N2O4 + GSH → C4H3N2O4• + GS• C4H3N2O4• + GSH → C4H4N2O4 + GS• C4H4N2O4 + O2 → C4H3N2O4• + O2•− + H+ C4H3N2O4• + O2 → C4H2N2O4 + O2•− + H+ Because it selectively kills the insulin-producing beta-cells found in the pancreas, alloxan is used to induce diabetes in laboratory animals. This occurs most likely because of selective uptake of the compound due to its structural similarity to glucose as well as the beta-cell's highly efficient uptake mechanism (GLUT2). In addition, alloxan has a high affinity to SH-containing cellular compounds and, as a result, reduces glutathione content. Furthermore, alloxan inhibits glucokinase, a SH-containing protein essential for insulin secretion induced by glucose. Most studies have shown that alloxan is not toxic to the human beta-cell, even in very high doses, probably because of differing glucose uptake mechanisms in humans and rodents. Alloxan is, however, toxic to the liver and the kidneys in high doses, as these are tissues where the GLUT2 transporter is expressed in humans. Streptozotocin
Sources: en.wikipedia.org
ABS-201 is an AI-designed monoclonal antibody against the prolactin receptor (PRLR) currently in Phase 1/2a clinical trial for the treatment of androgenic alopecia (pattern hair loss) and endometriosis. It is taken by subcutaneous injection. ABS-201 is a possible first-in-class drug with a novel mechanism of action in the potential treatment of hair loss. ABS-201 is under development by Absci. It is believed that ABS-201 works by activating dormant hair follicles and causing them to move from the telogen phase to the anagen phase. In human ex vivo scalp model studies, ABS-201 stimulated hair regrowth, prolonged anagen phase, blocked catagen phase, inhibited telogen effluvium, and blocked hair from losing color. ABS-201 has been found to produce robust hair regrowth as compared with minoxidil in mice and balding macaques. The clinical trial for ABS-201 is being overseen by prominent hair loss researcher Rodney Sinclair, one of the principal investigators in minoxidil clinical trials. The chemical structure of the drug does not yet appear to have been disclosed.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Amanda Grace Paulovich is an oncologist, and a pioneer in proteomics using multiple reaction monitoring mass spectrometry to study tailored cancer treatment. Paulovich received a BS in Biological Sciences from Carnegie Mellon University in 1988, a PhD in Genetics from University of Washington in 1996, under the direction of Leland Hartwell. She also received a MD from University of Washington in 1998. Follow her residency in Internal Medicine at Massachusetts General Hospital, she also completed a Postdoctoral Fellowship in Computational Biology at the Massachusetts Institute of Technology Whitehead Center for Genomic Research in 2003, and a Fellowship in Medical Oncology at the Dana Farber Cancer Institute in 2004.
Sources: en.wikipedia.org
It usually refers to the relative peak area of the target peptide in a chromatogram, not the mass fraction of the entire sample. Different analytical methods can yield different purity values. Water, counterions, and residual solvents are excluded unless the calculation specifies otherwise.
A single method can miss co-eluting impurities, salts, water, or structural modifications. Orthogonal techniques separate compounds by different properties, such as hydrophobicity, charge, or size. Combining results gives a more complete assessment of sample composition.
No, purity measures the amount of target relative to other peaks, not the identity or sequence of the target. Mass spectrometry and sequencing may be needed to confirm structure. A high-purity sample can still contain a peptide with an incorrect sequence.
Purity percentages vary because each laboratory uses its own column, mobile phase, gradient, detection wavelength, and integration settings. A 95% value from one method may not equal 95% from another method. Comparative assessment requires the same validated procedure or an orthogonal cross-check.